SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013447558.1.23723 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013447558.1.23723
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.75e-45
Family Ribosomal protein L20 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013447558.1.23723
Sequence length 119
Comment 50S ribosomal protein L20 [Mycoplasma leachii]; AA=GCF_000253095.1; RF=na; TAX=866629; STAX=2105; NAME=Mycoplasma leachii 99/014/6; strain=99/014/6; AL=Chromosome; RT=Major
Sequence
MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL
WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNNEEFKKIVKQAKKALNK
Download sequence
Identical sequences E4PTL6
WP_013447558.1.23723 WP_013447558.1.53025 gi|392388954|ref|YP_005907363.1| gi|313665131|ref|YP_004047002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]