SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013454690.1.33346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013454690.1.33346
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00000000667
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013454690.1.33346
Sequence length 166
Comment ATP synthase F0 subunit B [Marivirga tractuosa]; AA=GCF_000183425.1; RF=representative genome; TAX=643867; STAX=1006; NAME=Marivirga tractuosa DSM 4126; strain=DSM 4126; AL=Complete Genome; RT=Major
Sequence
MEQLVNDFSPGLFFMQLFIFGVLLLLLSKFAWKPILNSLKAREGSIADALQSAENAKEEM
AKLQADNQKLLQEARLERDKLLKEATDIANKIKEEAKSDAAKQADKMISDAKNVIEVEKN
AALKEVTTKVAELSLEIAEKLIRKNLSDDKAQKALAEDFMKDLKLN
Download sequence
Identical sequences E4TNY3
gi|313676659|ref|YP_004054655.1| WP_013454690.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]