SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013455367.1.33346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013455367.1.33346
Domain Number 1 Region: 119-241
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.96e-23
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0063
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013455367.1.33346
Sequence length 249
Comment succinate dehydrogenase/fumarate reductase iron-sulfur subunit [Marivirga tractuosa]; AA=GCF_000183425.1; RF=representative genome; TAX=643867; STAX=1006; NAME=Marivirga tractuosa DSM 4126; strain=DSM 4126; AL=Complete Genome; RT=Major
Sequence
MKFNLKIWRQKNNQDKGAFKTYELDGVSSDMSFLEMIDVLNEQLIDKDEDPVHFDHDCRE
GICGMCSMYINGEPHGPLRGVTTCQLHMRSFQDGETITIEPWRAKAFPIVKDLAVDRSAF
DRVIQAGGYVSVNTGGTPDANEIPIPKSVADEAFDAATCIGCGACVAACKNASAMLFVSA
KVSQLSMLPQGKVESAERAQKMVAQMDEEGFGACTNTGACSAECPKGIDLSNIARMNREY
LGAKIGSQD
Download sequence
Identical sequences E4TW07
gi|313677337|ref|YP_004055333.1| WP_013455367.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]