SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013455974.1.61437 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013455974.1.61437
Domain Number 1 Region: 12-354
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.79e-83
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013455974.1.61437
Sequence length 363
Comment pyruvate dehydrogenase E1 subunit alpha [Mycoplasma bovis]; AA=GCF_001930225.1; RF=na; TAX=28903; STAX=28903; NAME=Mycoplasma bovis; strain=2351MB; AL=Contig; RT=Major
Sequence
MNYKYVKPGHATSDPNETVRFLDVDGKLIQEYKPSEETKKKLVEMYKNMIRSRQWDLYSL
TLQKTGRLGTFAPALGEEAALTGIGYNLNKEDWFIPHYRVLPTQLARGISMDKIYSYWQG
SEIGSAFAGTNTLPLHVVIGSQVPIAAGVAQALKFQGKKALAMVTIGNGGTNEGEFHEGL
NMASVRKWPLVTVVMNNQWAISVPEHNSYIVKTLSQRAKSYDMPGVRVDGNDLIAVNEVM
QEVYDFVREGNGPVLVEMVTWRQGQHTTSDNPRVYRSRELEVEKEKWEPFHRIEAYLLSE
KLITEEDIKVWSEAAYEEAKAAYALSKELCEATTFDHIYDYTYEKLPADLVRQKETNRKL
FGK
Download sequence
Identical sequences A0A059XYH6 A0A193CK90 E4PZ46
gi|313678230|ref|YP_004055970.1| gi|339320623|ref|YP_004683145.1| WP_013455974.1.102037 WP_013455974.1.14198 WP_013455974.1.17077 WP_013455974.1.2028 WP_013455974.1.21240 WP_013455974.1.2669 WP_013455974.1.27818 WP_013455974.1.32249 WP_013455974.1.32382 WP_013455974.1.32703 WP_013455974.1.37991 WP_013455974.1.47380 WP_013455974.1.49663 WP_013455974.1.50201 WP_013455974.1.56049 WP_013455974.1.56372 WP_013455974.1.59238 WP_013455974.1.61074 WP_013455974.1.61437 WP_013455974.1.67253 WP_013455974.1.67779 WP_013455974.1.72194 WP_013455974.1.72927 WP_013455974.1.82377 WP_013455974.1.85199 WP_013455974.1.85958 WP_013455974.1.8756 WP_013455974.1.88257 WP_013455974.1.95878 gi|392429693|ref|YP_006470738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]