SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013456767.1.73382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013456767.1.73382
Domain Number 1 Region: 69-200
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000019
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013456767.1.73382
Sequence length 226
Comment hypothetical protein [Oceanithermus profundus]; AA=GCF_000183745.1; RF=representative genome; TAX=670487; STAX=187137; NAME=Oceanithermus profundus DSM 14977; strain=DSM 14977; AL=Complete Genome; RT=Major
Sequence
MKKFLALVALLFAIAWANPATLIDEGRFQQAYEEALAQGTATAYALAAKAASYYAGYVAS
TGKDKEAWFSKAEAAAKKAIAADPGYPEGYFELARAQGRLSQYRGILASLNLASSVRDNL
KKALELDPKHDSALVALALWNLELAQKGVGWMYGASIKRVEPLFQEAIALNPTAIAHRLE
YGGALIRLKKPERAREQLEKALELPARTWVDRADQEKARALLESLK
Download sequence
Identical sequences E4U5N9
gi|313679031|ref|YP_004056770.1| WP_013456767.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]