SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013457435.1.73382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013457435.1.73382
Domain Number 1 Region: 91-250
Classification Level Classification E-value
Superfamily TPR-like 5.46e-20
Family BTAD-like 0.037
Further Details:      
 
Domain Number 2 Region: 856-1019
Classification Level Classification E-value
Superfamily TPR-like 4.27e-16
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Domain Number 3 Region: 250-324,368-486
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000298
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Domain Number 4 Region: 707-819
Classification Level Classification E-value
Superfamily TPR-like 0.000000000345
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 
Weak hits

Sequence:  WP_013457435.1.73382
Domain Number - Region: 6-73
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00368
Family PhoB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013457435.1.73382
Sequence length 1079
Comment SARP family transcriptional regulator [Oceanithermus profundus]; AA=GCF_000183745.1; RF=representative genome; TAX=670487; STAX=187137; NAME=Oceanithermus profundus DSM 14977; strain=DSM 14977; AL=Complete Genome; RT=Major
Sequence
MAHGCRILLLGPPELWCGGARVHLPTARATALIAFLALQEEAVPRGRLAALLWDAPEATA
RHRLRQELYRLQRGPLGSFLQSDRKAVRLKGVESDAARFRAALERGAWPEALRLWRGPFM
DGFALSGAEAFEDWLALEREAWTDRYVLALSRRALELEAEGRLEPAAQLWRTVVEADAFH
EEAHRRLLWLLARSGRWPEADRLYRQYRERLERELGLEPDPETERLYRELAERKTPARPA
AAPVPETLADPPLVGREALLRELQRLHPQPVLLLGEAGSGKTRLAGEHLARLGGRLIIEH
PASSRALPFAGVARALDRALELQGLPELDPVWLREAGRLLPHRLPAPGRPLQGAADRTRF
LEGLSRVLLALAGPVLVWDDLQWTDPAAVELLAYLLPAASRAGVQAVLTVRRPIPPGPVA
DWLEPLEDDLARLEVPPLDEAAVHELIQRLAHQRYGARLFARRLHSATGGNPFFVLETLR
HLFARGELRLRGEGWSTPYDRTTEDYRELPIPRSIRETLWARLHALDGPLKRTLELVCVA
RSPVAPETLAQVLGVPELEAARHLEELRERQLTVDRAHGYAPAHEHLRALVLETLNPSLA
RTYHRAWARTLEAQGRHAQAAEHWQEAGLAERAAQGFIAAARRAPHDPLSARAYYLRALH
LAEALDPRLRQELELDLLELDLRLGRLDEAGRERLEQLAETVGARSRLLIAEALLQRGDY
PRALASARAGLARALREGDRACQARAHFLLAWIYYRHGDPGAQLAELEQALDAYLQIGDH
QGAARTLRNLAALYFRLGEKETGDALQARALEEAQAVGDGVLTLRIRADRATGRWLRGEF
PWVLREARALRRAARRLGDYGGELDALELEGLAALKLGDHAGAYRAFDAAVRRADELHLE
KDAALARSERAWASIELGSFAEAESDLRTALAVQRRIGDQAKLGHTYHTWGYLHLRRGDH
EEALRWFRRAARHWRARGERGHLARSLAYAALAAAASGRTRLAQRLSGEALRASHDWPVG
VPDRPLIWAVYARFHARGAPWSRKACDELRRLRAGLRPAARRRLAATFVYRTVCDGADL
Download sequence
Identical sequences E4U850
WP_013457435.1.73382 gi|313679699|ref|YP_004057438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]