SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013486143.1.100024 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013486143.1.100024
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.28e-57
Family PP-loop ATPase 0.0000749
Further Details:      
 
Domain Number 2 Region: 355-440
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0071
Further Details:      
 
Weak hits

Sequence:  WP_013486143.1.100024
Domain Number - Region: 208-304
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00068
Family MesJ substrate recognition domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013486143.1.100024
Sequence length 457
Comment tRNA(Ile)-lysidine synthetase [Ethanoligenens harbinense]; AA=GCF_000178115.2; RF=representative genome; TAX=663278; STAX=253239; NAME=Ethanoligenens harbinense YUAN-3; strain=YUAN-3; AL=Complete Genome; RT=Major
Sequence
MQARDTMKTYHLLAPGDAVLAAFSGGADSTALLHLLCALREEWGLRVFAAHLNHGLRGEE
ADRDEAFVRARCVEWGVPCFVRRTDVRAEAARTGESEELCGRRLRYAFFAEQAEALGAKI
ATAHTLSDSVETMLLNLARGTGLAGLRGIPPVRGNIVRPLIETTRAEVEVYCAAHGLNYV
TDSTNFSRAYGRNRIRLDVVPALRALNPALERTLARDMRLFARDEAVLEDLTASLLRAAA
VPGGFAAEVLRASPLCARALAAAAAQTTGLRPEAVHVRAMEQLLRTGAGRTQLRGGWFAE
IVRGVLSFSPGKEEPPAPFCRPLAPGVLENGPVRLKVTPVEHANVKKFESFCARYFKSVL
DCDKIIGKAVIRTRRAGDFYHPAGRGVGKSLKKLFNEQAVPPSLRPYVPVAADETGIIWV
GGFGPDARCAPDTGTRRVLFLAYDADTRKGATGDGGY
Download sequence
Identical sequences E6U4R0
WP_013486143.1.100024 gi|317133212|ref|YP_004092526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]