SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013490826.1.80543 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013490826.1.80543
Domain Number - Region: 12-89
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz beta-1 subunit 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013490826.1.80543
Sequence length 155
Comment hypothetical protein [Bacillus cellulosilyticus]; AA=GCF_000177235.2; RF=representative genome; TAX=649639; STAX=1413; NAME=Bacillus cellulosilyticus DSM 2522; strain=DSM 2522; AL=Complete Genome; RT=Major
Sequence
MHLEIKVIKDNNKNEYTHIKLPSPYLEEEINEIVGTDCYSIQFNKSIKNKVNLSIADINL
IAERLERYDTALVEAMYEYTGCLYETFVCLEEYRYQYKSGVSSLVEVAEEMVKLGYLGTN
DLSEEVLRYISFDKIARDLDAEGWKIINNIAILAY
Download sequence
Identical sequences E6TZ57
gi|317130949|ref|YP_004097231.1| WP_013490826.1.80543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]