SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013515378.1.85979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013515378.1.85979
Domain Number 1 Region: 45-387
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.65e-89
Family L-arabinose binding protein-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013515378.1.85979
Sequence length 388
Comment branched chain amino acid ABC transporter substrate-binding protein [Desulfovibrio aespoeensis]; AA=GCF_000176915.2; RF=representative genome; TAX=643562; STAX=182210; NAME=Desulfovibrio aespoeensis Aspo-2; strain=Aspo-2; AL=Complete Genome; RT=Major
Sequence
MRTKLHLIVLCLVMAAMLAACSAEEKKADEKADVQTGEVAPAAKLVLGVAGAHSGDLASY
GLPSVNAAKLVAAKVNAAGGVNGMTVEVVAQDDQCKPELATNAATKMVSDGVKIVLGHIC
SGATKAALPIYLESKIVLMSPSATNPPLTQSGEYPNFFRTIAPDDAQAALEVAFAKGLGL
TKLAVIHDKGDYGKGFATFCKEFIEAEEGMEVVLFEGVTPGAVDYSAVVQKIKSSGAQGV
IFGGYHPEASKIVSGMRKKEITIPFLSDDGVKDDTFIKVAGEYAEGVYATGPMDFSTNPV
YQEAVAAHKAEFGTDPGPFFPEAYSAALALLKAVENAGSTDYDKVTEALRTQYVDTAVGS
VKFDAKGDAEGVGFAVYQVQSGKYVEIK
Download sequence
Identical sequences E6VUV8
gi|317154164|ref|YP_004122212.1| WP_013515378.1.85979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]