SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013545213.1.88690 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013545213.1.88690
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.49e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 68-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.11e-25
Family Ribosomal protein L11, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013545213.1.88690
Sequence length 142
Comment 50S ribosomal protein L11 [Bartonella clarridgeiae]; AA=GCF_000518185.1; RF=na; TAX=1408425; STAX=56426; NAME=Bartonella clarridgeiae ATCC 51734; strain=ATCC 51734; AL=Scaffold; RT=Major
Sequence
MAKKSVGQLKLQIPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVIVT
YYQDKSFTFSLKTPPVSFFLKKAANLKSGSKEPGKVSVGTIPRDKIRSIAEAKMKDLNAN
DIEAAMRMVEGSARSMGLEVLG
Download sequence
Identical sequences E6YI91
gi|319899060|ref|YP_004159153.1| WP_013545213.1.47293 WP_013545213.1.88690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]