SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013546163.1.62754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013546163.1.62754
Domain Number 1 Region: 26-417
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.9e-103
Family NagZ-like 0.000000983
Further Details:      
 
Domain Number 2 Region: 418-660
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 6.54e-52
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013546163.1.62754
Sequence length 780
Comment beta-glucosidase [Bacteroides helcogenes]; AA=GCF_000186225.1; RF=na; TAX=693979; STAX=290053; NAME=Bacteroides helcogenes P 36-108; strain=P 36-108; AL=Complete Genome; RT=Major
Sequence
MNKKLILSLALSGLVLTTAAQTKVTPAIPQDAKMEQQIEKLLKKMTLDEKVGQMCELTID
LLQDRKANPSNGFRLSEAMLDSVIGKYKVGSILNVPNGIAQTPAKWQEIIKRIQEKSIKE
IGIPCVYGVDQIHGTTYTLGGTFFPQGINMGAAFNRELTRRGAEISAYETKAGSIPWTYA
PVTDLGRDPRWPRQWENYGEDCYLNAEMGREAVIGFQGNDPNHIGTRNVAACMKHFMGYG
APVSGKDRTPSSITVQDMREKHFAPYLEMVRNGALSVMVNSAMNNGLPFHANYELLTKWL
KEDLEWDGMIVTDWADIDNLWKRDHIAKDKKEAIKLAINAGIDMSMDPYDWRFCPLLKEL
VQEGEVPMSRIDDAVRRVLRLKYRLNLFEKPYYDLKDFPLFGGKQHAAAALQAAEESLVL
LKNTDAVLPLAKGKKILLTGPNANSMRCLNGGWSYTWQGSNAEACAEPYNTILEAFTNKF
GADHVIYEAGVTYNDKGNWWEENTPQIEKAVAAAAKADYIVACIGENSYCETPGNLTNLF
LSENQLDLVKALAKTGKPVILILSEGRPRIISDIEPLAKAVVDVMLPGNYGGDALANLIA
GDANFSGKLPFTYPKEINSLITYDYKPCEHIGKQMEGAYNYDAQVSVQWAFGYGLSYTTF
AYSNLKVNKPNFSANDELIFTVDVKNTGNCIGKESVLLFSSDLIASLTPDNRRLRAFEKV
ELNPGESKTVTLKLKASDLAFVGYDGKWILEKGDFRIQAGSQVMNVVCTDTKKWETPNKQ
Download sequence
Identical sequences E6SW22
WP_013546163.1.62754 gi|319900405|ref|YP_004160133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]