SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013546562.1.62754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013546562.1.62754
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Nudix 1.12e-33
Family MutT-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013546562.1.62754
Sequence length 177
Comment DNA mismatch repair protein MutT [Bacteroides helcogenes]; AA=GCF_000186225.1; RF=na; TAX=693979; STAX=290053; NAME=Bacteroides helcogenes P 36-108; strain=P 36-108; AL=Complete Genome; RT=Major
Sequence
MEHPLSQFKYCPKCGSAHFGVNNCKSKQCADCGFVYYFNPSSATVALILNEQNELLVCRR
AKEPAQGTLDLPGGFIDIAETGEEGVSREVKEETGMEVTKAEYLFSLPNTYIYSGFPVQT
LDMFFRCTVTDTVHFKAMDDAAEAFFLPLKEIRAEEFGLRSIRKGLEKFLEIKAPIP
Download sequence
Identical sequences E6SQ44
gi|319900807|ref|YP_004160535.1| WP_013546562.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]