SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013547356.1.62754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013547356.1.62754
Domain Number 1 Region: 299-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-36
Family ABC transporter ATPase domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 42-294
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.32e-18
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 764-837
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000889
Family Smr domain 0.012
Further Details:      
 
Weak hits

Sequence:  WP_013547356.1.62754
Domain Number - Region: 546-663
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0549
Family C-terminal domain of PLC-beta 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013547356.1.62754
Sequence length 839
Comment endonuclease MutS2 [Bacteroides helcogenes]; AA=GCF_000186225.1; RF=na; TAX=693979; STAX=290053; NAME=Bacteroides helcogenes P 36-108; strain=P 36-108; AL=Complete Genome; RT=Major
Sequence
MIYPQNFEQKIGFDQIRQLLKEKCLSTLGEERVTNMTFSDRFGEVEERLEQVTEFIRIIR
EEDNFPAQYFFDVRPSLKRIRVEGMYLDEQELFDLRRSLETIRDIVRFLQKENEEDNNSP
YPCLKRLAGDIMAFPQLIGKINNILSPYGKIKDNASSELARIRRELASTMGSISRSLNNI
LRNAQSEGIVDKDVTPTIRDGRLVIPVVPALKRKLKGIVHDESASGKTVFIEPAEVVEAN
NRIRELEGDERREIIRILTDFSGQLRPSIPDVLLSYEFLAEIDFIRAKAMFAEQISGLKP
ALENKQILDWTMAVHPLLQLSLAKHGKKVVPLDIELNEKQRILVISGPNAGGKSVCLKTV
GILQYMLQCGLLIPMHERSHAGIFSNIFIDIGDEQSLEDDLSTYSSHLTNMKIMMKHCNE
CSLILIDEFGGGTEPQIGGAIAEAVLKRFNEKLTFGIITTHYQNLKHFAEDHEGVVNGAM
LYDRHLMQALFQLQIGNPGSSFAVEIARKIGLPEDVIADASEIVGSEYINADKYLQDIVR
DKRYWEGKRQTIRQREKQMEETIERYQTEIEDLRKSRKEILRKAKEDADILMQEANARIE
NTIRTIKEVQAEKEKTRQVRKELADFRESMETLANKEQEEKIVRQMERLAEKQNRKKEKK
NRKEQNPQTLAAQQTRKETERTAVITPGCHVKMKGQASVGEVMEVNGKNATVAFGNIKTT
VKLERLECTNAQPKQADTSTKSTYISTQTQDSMYEKKLNFKQDIDVRGMRGDEALQAVTY
FIDDAILIGMSRVRILHGTGTGILRTLIRQYLQTVPGVRQFADEHIQFGGAGITVVDLN
Download sequence
Identical sequences E6SNL3
gi|319901620|ref|YP_004161348.1| WP_013547356.1.62754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]