SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013559104.1.30606 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013559104.1.30606
Domain Number 1 Region: 94-179
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000209
Family MJ1460-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013559104.1.30606
Sequence length 184
Comment hypothetical protein [Anaerolinea thermophila]; AA=GCF_000199675.1; RF=representative genome; TAX=926569; STAX=167964; NAME=Anaerolinea thermophila UNI-1; strain=UNI-1; AL=Complete Genome; RT=Major
Sequence
MALSHFPEIHQVLLESTHEVLGKGQSGFLQPEEKTFLTELERLLTEQFGTLTGRGMAIRM
GRSGFQTGLRRWGETLGFYSLDFRLMPFPRRVRFGLDQIARFLEERTSLQINIHEEPEHW
IVEIRQMPSCTRSTSPVLCSLLMGMFQEFMQWQGSGRFFPVRETQCVAQGSPCCRFEISR
KPLE
Download sequence
Identical sequences E8N1V5
gi|320160086|ref|YP_004173310.1| WP_013559104.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]