SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013562106.1.43297 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013562106.1.43297
Domain Number 1 Region: 6-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-42
Family Extended AAA-ATPase domain 0.0002
Further Details:      
 
Weak hits

Sequence:  WP_013562106.1.43297
Domain Number - Region: 234-358
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0138
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013562106.1.43297
Sequence length 425
Comment MULTISPECIES: replication protein C [Desulfurococcus]; AA=GCF_000186365.1; RF=representative genome; TAX=765177; STAX=2275; NAME=Desulfurococcus mucosus DSM 2162; strain=DSM 2162; AL=Complete Genome; RT=Major
Sequence
MSHQRVPWVIKYRPRTLEEFEDQEEAKEKLIAWLESWEKGVPGKKAALLHGPPGCGKTSL
VEAVARSKGYQLFEMNASDARRKEDIDRIVKLASRSGALTGSRKIILLDEVDGMDPRADA
GGIEALVEVIKATANPIIMTANNPYSQALRPLRELSEVIGFKRLSESVVVKVLKKICGAE
KLFCEDEALREIARRSEGDLRSAINDLEALAGLSGGVTVNAVKELSTYRNRVYAPYEALQ
KLFNARYIFQAKEYATSTDLAPDEFIIWINEHIPTYYEDPEEVARAYDALSRADVYMGRI
VRTQNWDLLSYVLEMMGPGVAFARKTYRYRWKPFKSPERLKLMSEAKRSREIRESLAEQL
SRRLLTSKTVVRSDVIPFLRVIFRHNPKYAAKLAKGYGLPEEVVKWLAGTRGSEILGYMR
KTRTK
Download sequence
Identical sequences E8R8Q8
WP_013562106.1.43297 WP_013562106.1.60640 gi|320100774|ref|YP_004176366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]