SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013562115.1.60640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013562115.1.60640
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily LigT-like 2.09e-41
Family 2'-5' RNA ligase LigT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013562115.1.60640
Sequence length 191
Comment RNA 2',3'-cyclic phosphodiesterase [Desulfurococcus mucosus]; AA=GCF_001006085.1; RF=na; TAX=675631; STAX=2275; NAME=Desulfurococcus mucosus DSM 2161; strain=DSM 2161; AL=Scaffold; RT=Major
Sequence
MSSELVRSFIAIEVKNRDVLRRLIEARDRVAGVGVDLKPVEDENIHLTLRFIGEVPRSTV
EEVCGIVTGISFKPFEMHVKGIGGFPSLERPRVIWAGIEEGAGELLELYRVVEAGLRRLG
VKPEREEFTPHITLARVKGYRGLEKLVKVLLEMRDMDFGYTPVDEVIVKKSVLTPRGPIY
SNICVKKLVQQ
Download sequence
Identical sequences E8R8R7
gi|320100783|ref|YP_004176375.1| WP_013562115.1.43297 WP_013562115.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]