SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013565741.1.76794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013565741.1.76794
Domain Number 1 Region: 269-483
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000302
Family alpha-mannosidase 0.076
Further Details:      
 
Domain Number 2 Region: 622-800
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000691
Family alpha-mannosidase, C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013565741.1.76794
Sequence length 1028
Comment glycoside hydrolase family protein [Isosphaera pallida]; AA=GCF_000186345.1; RF=representative genome; TAX=575540; STAX=128; NAME=Isosphaera pallida ATCC 43644; strain=ATCC 43644; AL=Complete Genome; RT=Major
Sequence
MSDPSVASESDPRPDANASAASASEAASRSLSDPATGPLNRRRVVVAIPDLGTEPPPNDP
ENEPWLLERSERLARGVWVAASSPFHPAVLGSCGVTPDFEPAEAPAPPELDTIRLVVHGC
LDRLPSGHLTAAADLGVPVVEADLGRRATIRRLLERLAPERAESPDPDDPEGLKLAGDFL
ALGTARFQLEELTRAVGHGETLDRDAFDRETLKGARAWLEGDWPTATGRLRAAFELLTQA
RERFYPMDAYLIDLTLLEDSTPPESLHALLREGPATTLMATGRAVETLGQRHPALLETIR
EAVSLGRLDLIGGPLEELEEAFMPLESVLWQYRRAADAYRTHLDERTVETLARRRFGLSP
GMAAITAKLGFRFALGWCLDEGVFPTAAEVKRLWDDGDGSSLECLFRTPDRADREAAGRR
LPWRLGKSMNLDGSAVVLLAHWPEPVAAWYHEARRIASYSPVLARWVTVGDFFHYTDRPY
DGFHPHPDQFLSPWLSQAVRRGEGHPISRWVAHQRDRMALDSAAAAVALRLALQGGGGAF
DPSAFVTESNRAGEPLNVTAGLLTAAEDRLEASMGAGPVAPEGAAALPPPGDLAQAAATA
LAAVILGDPARVAAPRVRPEGYLVLNPTGRTRRVVVSLPEAAPDLKPSGPLLAAQLTETG
VRGVVEVAGFGFAYVPASSPLEAPPAPLGILSFSDMTLSNGLIRVEIDKTTGGLRSIRAA
DESTPRLAQRLVAVKDGQDATRMVKLRHDVDYAGPALVQAWTEGTLDDDKGCALARFRQT
YRLYAGQTRVEIEIRLEQLDGDFEARLGSRSSNPWTDFVACRWAWPDEAAALHRLHRHAL
FETQSRRPETSEGLLVEVRHREVGLLTGGLPYHQRKGGRMLDTLLVAGAEQTRIFNLAVV
LNPSDLHAAAVDAFAPGLAVPILGGPPASGPTGWLVRVDSPHVAVTRLEHLASGRSGDGR
GWGLALHLIETAGRPGRCKIHFFRDPVWARQTDFLEQTMVDATIDGDSVLVDFTPHELTR
LDVTLAAE
Download sequence
Identical sequences E8R1N5
gi|320104411|ref|YP_004180002.1| WP_013565741.1.76794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]