SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013566931.1.63843 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013566931.1.63843
Domain Number 1 Region: 83-279
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.97e-65
Family B3/B4 domain of PheRS, PheT 0.0000125
Further Details:      
 
Domain Number 2 Region: 364-574
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00014
Further Details:      
 
Domain Number 3 Region: 591-681
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.07e-18
Family Anticodon-binding domain of PheRS 0.0011
Further Details:      
 
Domain Number 4 Region: 294-371
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000696
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 
Domain Number 5 Region: 1-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000156
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013566931.1.63843
Sequence length 688
Comment phenylalanine--tRNA ligase subunit beta [Terriglobus saanensis]; AA=GCF_000179915.2; RF=representative genome; TAX=401053; STAX=870903; NAME=Terriglobus saanensis SP1PR4; strain=SP1PR4; AL=Complete Genome; RT=Major
Sequence
MKILSSWLREFLPSLTVDDHHLAEDLTLRGIAVEGVHEVEGGHLFEMDITTNRVDAMNHY
GVAREAAAIYGIPLMKIEDDCHAATTGDGYPVRIEAEDLCGRFTAQVVRGVNVAASTGLM
AERFAQLGQKPISNVVDVTNYTWLAMGHPTHAFDLDTLEGAIVVRRAREGEKLHLLDGSE
KTLTAEDLVVADEKKALALAGVMGGWDSRVTESTKNVLVEAAWFDQAAIRASSKRHGLHT
DASHRFERGADFAAAPVANRYVVKKLVEWCGGTAEGGMTDIVVSAIEARTAKRPHIAMSA
EEVRRLLGTTLEGGLVSADDIEKYLEALGCGLRPAAIVGTYEVALPSWRLDLEREIDLIE
EVARVYGYNRFADTLPAFSGGIIALPHVEQERVLRETLRGLGWSEVIGSTFCSEADAATF
AGEKGVVAMGNPLNAEAGVLRPSLLPGAVTMLAGNLNRDVREARVFEIGAVFTGSTAEVH
EEPSLALAAYGGARATQTISERDALFFEMKGAVEGLLAKFAPVGVSYEASPLPAWMEPGR
GARVLRGGEEIAVIGELSAAIAEKRKLKQVVVLGEVRAVKLLATPLRTPLAKEPSRFQAV
DRDLSFLFSDAVRWGAIESAIRGVGAAELVSVEPLEIFRGKTVAEGEYSLLLRIVLQAAD
RTLREDEVTGIVERVTQALASLGGKQRA
Download sequence
Identical sequences E8V1K3
WP_013566931.1.63843 gi|320105602|ref|YP_004181192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]