SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013568837.1.63843 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013568837.1.63843
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000123
Family Terminase gpNU1 subunit domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013568837.1.63843
Sequence length 70
Comment DNA-binding protein [Terriglobus saanensis]; AA=GCF_000179915.2; RF=representative genome; TAX=401053; STAX=870903; NAME=Terriglobus saanensis SP1PR4; strain=SP1PR4; AL=Complete Genome; RT=Major
Sequence
MSPLGETPAKFLTAEEAAVHLGCLNSRTVSRWAREGYLPAYALGEGKRRLWRFLLTDLDA
WMRARRTVTA
Download sequence
Identical sequences E8UXT8
gi|320107508|ref|YP_004183098.1| WP_013568837.1.63843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]