SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013593145.1.49867 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013593145.1.49867
Domain Number 1 Region: 103-248
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.7e-30
Family PA2201 C-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013593145.1.49867
Sequence length 249
Comment hypothetical protein [Acidovorax avenae]; AA=GCF_000176855.2; RF=representative genome; TAX=643561; STAX=80867; NAME=Acidovorax avenae subsp. avenae ATCC 19860; strain=ATCC 19860; AL=Complete Genome; RT=Major
Sequence
MRDNKKAAGYFADNISFSTKAMLKRFQDTEEFPRVEGRPGRAHDLVLYALQIVILRYSAG
DEIQAIKASVLQWIEARELQQRVLAPLPPKHEDKAMYERITLDTVYDALTMMAFGKALHF
NASEMKRLINAIGHPGEDALIDEGARALGDAQRPVAEACKFPKVYDPLLEVWRCDPSERP
AKLLAFSKVWKKKIKPIYWSDSLNGADGAYFGYWCFDVALAAIALDIPDEALRDNPYYPK
DLVDAARAK
Download sequence
Identical sequences F0Q731
gi|326315485|ref|YP_004233157.1| WP_013593145.1.49867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]