SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013596263.1.92537 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013596263.1.92537
Domain Number 1 Region: 14-197
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.28e-54
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013596263.1.92537
Sequence length 203
Comment chemotaxis protein CheB [Acidovorax avenae]; AA=GCF_001282395.1; RF=na; TAX=80867; STAX=80867; NAME=Acidovorax avenae; strain=T10_61; AL=Contig; RT=Major
Sequence
MIRPTAAPQVPARPFEAIVIGGSAGSIEALSVLLPALGPAQRAAVFVVLHLPRDRRSLLC
EIFQPRCALPLREAQDKEPVEAGTVYFAPPDYHLLIDAGPSLALSVDDPVHFSRPSIDVL
FESAADAYAGRLLAILLSGANHDGAQGIAAVQAAGGTTIVQDPESAPMSSMPEAALQLCT
PAHVLSPQRIADWLAALPPGGRA
Download sequence
Identical sequences F0Q2M0
gi|326318682|ref|YP_004236354.1| WP_013596263.1.49867 WP_013596263.1.92537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]