SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013598747.1.43610 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013598747.1.43610
Domain Number 1 Region: 15-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.63e-53
Family PP-loop ATPase 0.0000742
Further Details:      
 
Domain Number 2 Region: 314-426
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000915
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.043
Further Details:      
 
Weak hits

Sequence:  WP_013598747.1.43610
Domain Number - Region: 244-279
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.0785
Family S-adenosylmethionine decarboxylase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013598747.1.43610
Sequence length 431
Comment MULTISPECIES: tRNA(Ile)-lysidine synthetase [Weeksella]; AA=GCF_001809725.1; RF=na; TAX=1715139; STAX=1715139; NAME=Weeksella sp. HMSC059D05; strain=HMSC059D05; AL=Scaffold; RT=Major
Sequence
MNLKTEIQNRIENNQLGKAKFLLTISGGVDSMVLFHIFRQLSYTFSVAHCNFQLRGNDSD
LDEKLVVDTCTKNKIPFFVEKFDVKEYQSTGNYSIEMACRNLRYEWFNKLLITHKFDYLV
MAHHLNDQLETLLINLSRGSGSKGLMAMEEISNKIFRPLLTFSKKEIVDYAMQEKIIWRE
DLTNQENDFIRNQIRNQITPLLEEIHPQFLKNVNKSLAILAEENQLIENYLQTKKKELFR
QEKEYEVVKINSLEKLSPINTHLHYFFSPFGFSVNEIRKLLIASTGAEMQSETHRILKNR
NFLLIKKKENKKNDLYVIHSIENSYYCPNLFFQKTKRHPTHADETLDYDKIKFPLVFRPI
EEGDVFFPLGMKGKKKVSKFLKDEKLSKFDKEKVRVLVDNQQQILWVYPLRIDERYKITQ
ETINFLNIKIC
Download sequence
Identical sequences F0NZL1
gi|325955276|ref|YP_004238936.1| WP_013598747.1.43610 WP_013598747.1.86615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]