SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013605254.1.51010 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013605254.1.51010
Domain Number 1 Region: 52-296
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.7e-26
Family Aldo-keto reductases (NADP) 0.00093
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily L-aspartase-like 0.000000769
Family HAL/PAL-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013605254.1.51010
Sequence length 303
Comment aldo/keto reductase [Vulcanisaeta moutnovskia]; AA=GCF_000190315.1; RF=representative genome; TAX=985053; STAX=985052; NAME=Vulcanisaeta moutnovskia 768-28; strain=768-28; AL=Complete Genome; RT=Major
Sequence
MSRSRRSLEEIIHSGVKIYGVNTGLGDLYNVPVSPEDVAKYSLDILNEVARVLSELLGYD
VNVFTKVGYEVGKLVNGRHVQNFSVNYIVNAVRESFRRLGRRITLLQLHNPPISVIRDRE
LHRALLKLVDEGYIEHLGVALGPETNVLSEGLAAIDEGYEAIMFVFNILEQEPGRTLIRR
GMENAVGLITRVPHASNVLTDRQEVNFGSRDHRSLRDRDWLARAVGFTNTRIRPIAKSLG
MDLETLAIKYVLTYPISTVMVTATSIDELVKYVNAADGNYLNSDVIKTLEKLYAEFTEPI
AVK
Download sequence
Identical sequences F0QVR8
WP_013605254.1.51010 gi|325969402|ref|YP_004245594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]