SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013625499.1.55828 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013625499.1.55828
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-34
Family Methylenetetrahydrofolate reductase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013625499.1.55828
Sequence length 247
Comment methylenetetrahydrofolate reductase [Syntrophobotulus glycolicus]; AA=GCF_000190635.1; RF=representative genome; TAX=645991; STAX=51197; NAME=Syntrophobotulus glycolicus DSM 8271; strain=DSM 8271; AL=Complete Genome; RT=Major
Sequence
MNKIAVELVPRDERSLISELSLINSRFPLIKTINFPDLLRFDLRSWEGCRIAQRYFQDVI
PHIRAMDIKLSDELPMQGFLIEHKINQVLVVTGDLPQDMTKKIYPSTSIEVIKKFKREMP
GIKVYAAVDPYRKSVREELEYIRRKLEAGADGFFTQPFFDLRLMEIYAEILDGCEVFWGI
SPVTGEKSVNYWETKNNVVFPRGFEPTLKWNVNFAKQALALTESRKDNIYFMPIRTGLEE
YLRGIFG
Download sequence
Identical sequences F0SUR8
WP_013625499.1.55828 gi|325290454|ref|YP_004266635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]