SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013628121.1.67628 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013628121.1.67628
Domain Number 1 Region: 166-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-64
Family Methylesterase CheB, C-terminal domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily CheY-like 7.83e-29
Family CheY-related 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013628121.1.67628
Sequence length 364
Comment chemotaxis response regulator protein-glutamate methylesterase [Rubinisphaera brasiliensis]; AA=GCF_000165715.2; RF=representative genome; TAX=756272; STAX=119; NAME=Rubinisphaera brasiliensis DSM 5305; strain=DSM 5305; AL=Complete Genome; RT=Major
Sequence
MNNQPIKVLIVDDSAVIRGLLAKALVRDAEIEVVGTAMHGDAALSWLKDRPADVVILDVE
MPVMDGLETLKQLREQHPEIRVIMASSLTSSGAKTSMIALSLGADACIAKPTAGSASEAM
QTVAGELIPLVKGLCGRGPARPSPPPPAVANTFLPTVRKKDSIAPPKLLVIGSSTGGPNA
LNRVLTDLGRDFKIPTLIVQHMPPMFTGMMARHLQSDVGRPVKEAEAGEKLQQGVTYVAP
GDFHMQLEENSDGMSLSLNQDPVEHYCRPSVNPLFRSAARLAGPRTLAVMLTGMGSDGFE
GTRDIVAQGGYVLAQDEASSVVWGMPGSIVNAGMAHEVLPLQEIGSRIINLCSTATSRAR
MECS
Download sequence
Identical sequences F0SG52
gi|325108348|ref|YP_004269416.1| WP_013628121.1.67628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]