SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013638482.1.33556 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013638482.1.33556
Domain Number 1 Region: 1-286
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.84e-64
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013638482.1.33556
Sequence length 295
Comment 5,10-methylenetetrahydrofolate reductase [Desulfurobacterium thermolithotrophum]; AA=GCF_000191045.1; RF=representative genome; TAX=868864; STAX=64160; NAME=Desulfurobacterium thermolithotrophum DSM 11699; strain=DSM 11699; AL=Complete Genome; RT=Major
Sequence
MSFSKKIKNGKFIITAEVAPPRGIEWKTVIESIEPLKGKVDAFNVTDNQRSMVRMSSLAM
SKLLLDSGFEPIFQLTCRDRNRIALQSELLGAAALGIKNVCLMTGDFTTLGDQPDAKPVF
DIDSIHLIQTAKKLESGVLLNGKELKGVPNFTVGAVYNPFAGPKVLQVWKLRKKIEAGAE
FIQTQPVYDVRVAKDVHDLIESLGAIPIIGLLPIKSLKMANFMKKLNPTSIPNRLIEGLE
RANNPAQYGWDYVIDIAHAIAEFGKGIHFMLVGKTAELAAFIDYLRNNSPYNHKF
Download sequence
Identical sequences F0S3V7
WP_013638482.1.33556 gi|325295074|ref|YP_004281588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]