SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013667001.1.8815 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013667001.1.8815
Domain Number 1 Region: 628-796
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.18e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 101-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.66e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0047
Further Details:      
 
Domain Number 3 Region: 492-636
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.03e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 
Domain Number 4 Region: 2-133
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013667001.1.8815
Sequence length 833
Comment nitrite reductase large subunit [Sphingobacterium sp. 21]; AA=GCF_000192845.1; RF=na; TAX=743722; STAX=743722; NAME=Sphingobacterium sp. 21; strain=21; AL=Complete Genome; RT=Major
Sequence
MKIIIVGNGMVSYKFCEKIRKKSNSNHIEITVYGEEHRPAYDRVHLSEYFSGKSADDLLL
APTGWYNEHHIKLVTGELVTEIDPTKKKITTHKGTSDSYDKLILATGSSPFIPPLHGIDK
TGVFAYRTIEDLQQMEIYGKTAKKAVVIGGGLLGLEAAKALLDMGLETHIVEFADRLMPR
QLDVRGAFILRNKLSALGLHIHTSKSTKEILGTDKIAGLAFADGSILDCDMLVISAGIRP
RDELASKSGIQTGSRGGILVDNHLQTNFPDIYAIGEVALHNEMIYGLVAPGYEMAEVVAS
RLCGDYDKSFTGFDMSTKLKLIGVDVASFGDALDPEEECVPIVFENKAKGVYKRINVTRD
GKYLKGGILVGEADSYNMLLQIAQNGLPLPEDPADLILGSRSAGQSSGQGVDSLPDTAQI
CSCEGISKGNICEAIAKDELTDLAGIKKATKACTGCGGCTPLVADLLKSVLESQGKVVKK
TLCEHFAYTRQELYDLIKIQNIKSYSELLGRYGEGDGCEVCKPAVASLLASIWNEVILKQ
STIQDTNDRFLANIQKGGSYSVVPRIPAGEITPDKLLVIAQVAKKYNLYTKITGGQRIDL
FGAQLHELPAIWEELIAAGFESGHAYGKSLRTIKSCVGSTWCRFGVQDSVGFAIEIENRY
KGLRAPHKLKGAVSGCIRECAEAQSKDFGIIATEKGWNLYVCGNGGARPQHAQLLIGDID
KDSCIRYLDRFLMYYIKTAEPLTRTATWLNKLEGGLPYLYDVVVNDVLGIGAELEVEMES
LIANYECEWKHAVENESIRRRFKHFANSDEGDPFLQFEELRGQRIPTNWNVIV
Download sequence
Identical sequences F4C4C2
WP_013667001.1.8815 gi|326801135|ref|YP_004318954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]