SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013696448.1.97841 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013696448.1.97841
Domain Number 1 Region: 16-288
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.3e-98
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000169
Further Details:      
 
Domain Number 2 Region: 289-313,359-444
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.05e-20
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013696448.1.97841
Sequence length 460
Comment MULTISPECIES: cytochrome b [Burkholderia]; AA=GCF_001527485.1; RF=na; TAX=28095; STAX=28095; NAME=Burkholderia gladioli; strain=MSMB1756; AL=Contig; RT=Major
Sequence
MATDNKNVSTTGFIGWIDERFPLTASIKKHVTEYYAPKNFNFWYFFGSLALLVLVNQIVT
GIFLTMNYKPDSTLAFASVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLLYGSY
RKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIR
GDYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSNNPDGIEIKEKKDENGIPL
DGIPFHPYYSVHDFLGVCVFLMIFALIVFFAPEMGGYFLEANNFIPANPLQTPPEIAPVW
YFTAFYAMLRATTDPFKIVLMVVIVLLGIVALLRARGKWRIGLPVLAAALVVFMALTESK
FWGVVVMGSAVVSLFFLPWLDRSPVKSIRYRPTFHKVFLGIFVLAFFTLAFLGTQSPSPA
KTLIAQFCALIYFAFFLGMPFWTRLGTFKRPPERVNFRPH
Download sequence
Identical sequences A0A095W919 F2LI10
WP_013696448.1.10250 WP_013696448.1.1979 WP_013696448.1.34339 WP_013696448.1.40080 WP_013696448.1.51104 WP_013696448.1.70250 WP_013696448.1.7600 WP_013696448.1.77502 WP_013696448.1.80089 WP_013696448.1.81858 WP_013696448.1.97841 gi|330815338|ref|YP_004359043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]