SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013737206.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013737206.1.2613
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.02e-17
Family Ribosomal protein L39e 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013737206.1.2613
Sequence length 51
Comment 50S ribosomal protein L39e [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MSRYKPSGVKRRLSKALKSNSAVPAWVILKTNGKFRLNPKRRNWRRNDLKV
Download sequence
Identical sequences F4G118
WP_013737206.1.2613 gi|330834464|ref|YP_004409192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]