SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013737900.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013737900.1.2613
Domain Number 1 Region: 91-212
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.000000000405
Family Band 7/SPFH domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013737900.1.2613
Sequence length 291
Comment hypothetical protein [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MSLQFRGQVISTEREDGTSLMAPDVLIFRYPKEQITSKSLFIVQPTENCVVVIQGQVQAV
LPPGTHNIQSPQNPLSSFMSRFRYNQLPFDTVALFVSTTRHEVRIQGKSQTDDLVPLDYE
VAVYYRITDPSKLVINVQFAGAFFKDGELASYLSPIIDQEVSSILNQVKLVDVYKKFGDI
SVAVTGALKQFLAELGVELISVRVTRLIPEDPELRRIIQLRDLGLEVEKAVRMGLARVLT
EQGNPASVNMAIGTPYYPNLTTLVNLPQRLLQFSMGGKEVEKDEQDQPKGA
Download sequence
Identical sequences F4FY29
WP_013737900.1.2613 gi|330835158|ref|YP_004409886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]