SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013738382.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013738382.1.2613
Domain Number - Region: 40-115
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0127
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013738382.1.2613
Sequence length 127
Comment hypothetical protein [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MDIASRHNYVTGLSMLEILTLIGLYSAGMSIPIFNLGLEGSAITAHIYGAITIAILNVLI
LAAAMRTNELGLKVLSFINVIFVLIAAFEGLFYFGGFIDPSYALGMAIGFVGTLFSGSAV
LFYCLSR
Download sequence
Identical sequences F4G0S5
WP_013738382.1.2613 gi|330835640|ref|YP_004410368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]