SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013741833.1.69223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013741833.1.69223
Domain Number 1 Region: 156-343
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.67e-71
Family Methylesterase CheB, C-terminal domain 0.000000173
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 8.11e-29
Family CheY-related 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013741833.1.69223
Sequence length 351
Comment chemotaxis response regulator protein-glutamate methylesterase [Pusillimonas sp. T7-7]; AA=GCF_000209655.1; RF=na; TAX=1007105; STAX=1007105; NAME=Pusillimonas sp. T7-7; strain=T7-7; AL=Complete Genome; RT=Major
Sequence
MKKIRVLCVDDSALVRGLMTEIINSQPDMEVVASAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLERLMRLRPMPVVMVSSLTERNSEVTLRALELGAVDFVTKPKLGLRDGLMEYS
LLIADKIRAAAHSRPRYAAPPATTAPRKQLTHVFSGTEKLVMIGASTGGTEAIRQVLEPL
PANSPAIMITQHMPAGFTKSFVQRLDSLCAVQVHEAEDGQRVLPGHVYLAPGGIAHMKLA
RSGANYVVKLEYSDPVNRHRPSVDVLFHSAAQVAGRNAVGAILTGMGKDGAQGMLAMRQA
GAQTFAQDEASCVVFGMPREALHIGATDVAVPLSEMSARILASAGSYGHRV
Download sequence
Identical sequences F4GPG2
WP_013741833.1.69223 gi|332284007|ref|YP_004415918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]