SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013742416.1.69223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013742416.1.69223
Domain Number 1 Region: 86-183,321-389
Classification Level Classification E-value
Superfamily TPR-like 0.00000000446
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013742416.1.69223
Sequence length 511
Comment heme biosynthesis protein HemY [Pusillimonas sp. T7-7]; AA=GCF_000209655.1; RF=na; TAX=1007105; STAX=1007105; NAME=Pusillimonas sp. T7-7; strain=T7-7; AL=Complete Genome; RT=Major
Sequence
MRTWFWTLLVLAAAVGLALLLREHSGNVLIVAQPWRVELSLTLAVLLILASFVILYCLLR
VLAWIGVRPERFRSWRSQRSQKREHELLENGWINVLEGRYPDAEKDLSKLLTRSKSKSRK
VLAGLASARASQHMGEYGRRDEALTLARQNAQDNPRLSEATAIVAAEMYLDQNRPQDALV
LLQPLQDATTRYFHATRLLLRAHRQLRNHDRVFELTRLLSRRGVLEKSEAVQLIETSAAA
RLRAGGVEGFKSIWSDLKSDERALPDVALAAADIQTAQGNIDEASKILETGISARLDPRL
LNAYSQCPPEHVARRLSKAEDWLKTHPDDSALLAALGNLCLTGQLWGQGERYLLRSMKIR
SDMRIHALLGNLYDRLGRPNDAMTHWRLASGVAGVLPVLPSSRSLPAADTRGDPTLVDVE
RLPPEAQVLRDMQVPLAASAADFVNDDDFVSAGQPVAGPAGADSVAPATPAVQQPIDTQD
SYLDEYFDSAPIPGVDLSQTSDRPRHGSGHD
Download sequence
Identical sequences F4GUP8
gi|332284593|ref|YP_004416504.1| WP_013742416.1.69223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]