SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013763611.1.50710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013763611.1.50710
Domain Number 1 Region: 239-582
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.27e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.00044
Further Details:      
 
Domain Number 2 Region: 51-237
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.42e-16
Family Penicillin binding protein dimerisation domain 0.0098
Further Details:      
 
Domain Number 3 Region: 656-700
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013763611.1.50710
Sequence length 708
Comment peptidoglycan glycosyltransferase [Haliscomenobacter hydrossis]; AA=GCF_000212735.1; RF=representative genome; TAX=760192; STAX=2350; NAME=Haliscomenobacter hydrossis DSM 1100; strain=DSM 1100; AL=Complete Genome; RT=Major
Sequence
MEIKNEILYRIYFLLFGIFIPASVIMVWRTINISVVQGEDWRQRGKDNYVRFKAIEADRG
NILAMDGSVLSTSIPYFDLYFDPVAPQVKDFNENIDSLSYCLARYVDDTYTPGGLRDYFI
RARADSSNRHILIKKGATFIEKDRIEKYPLFNRGRFRGGLIVEQRNERRRPFGLLAQRTI
GYVRESAKPVGIEGAMDSILRGQPGGQMMIRVDAKKDIWLPLEDLTAMDPKSGDDVMTTI
DVNIQDITENALLRGMNAHDAEWGTAVVMDVKTGAIRAIANLGRGETGWWESFNYAIGSS
VEPGSTFKTATMLALLEDGVIKLEDSININHGKAQFFESFMVDASPESTALDTISIQKAF
EISSNVGIAGLAQRYYGSGNGPDRFIRRLKQFNLHLPSGIEVEGEANPYLKEAFSETWSG
ISLPWISHGYELRITPLQLLSFYNSIANNGIMMKPYLVSGTQRYGEMLEEFPPTVVKRQI
ASERSIERIRKLLEGVVNDGTARKLHTDAYNFAGKTGTAQINYRRSGNNIKIGGYRASFV
GYFPAESPRYSCIVVIHRPRKAGFYGSDVAGPIFREVADKIMASGSNHQSPINLAERPVM
KNEALPGLDVGAAADLRTAMKYLDLPFYGRPGTEMAVIRTHADSIMFQDRQLVERLVPNV
LGMTLRDALYALENAGLKVRLNGVGKVISQSVPPNTKVRGQMISITLR
Download sequence
Identical sequences F4KSU9
WP_013763611.1.50710 gi|332663141|ref|YP_004445929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]