SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013765949.1.50710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013765949.1.50710
Domain Number 1 Region: 242-594
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.04e-84
Family beta-Lactamase/D-ala carboxypeptidase 0.00037
Further Details:      
 
Domain Number 2 Region: 47-240
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.31e-39
Family Penicillin binding protein dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013765949.1.50710
Sequence length 628
Comment penicillin-binding protein 2 [Haliscomenobacter hydrossis]; AA=GCF_000212735.1; RF=representative genome; TAX=760192; STAX=2350; NAME=Haliscomenobacter hydrossis DSM 1100; strain=DSM 1100; AL=Complete Genome; RT=Major
Sequence
MDIGSNRQQVIQMVFIAAAALLLVKVFVLQVVNGEFKQQDKASGAVARYPIYPARGLIYD
RKGKLLVVNNPMYDLMVTVDAMDTSINVNRFCALVGITPDEYKKALDKDFRSGRFSRSVP
FVFKSKISAEAFARFQEALPEFPGFEIVLRNAREYPAPVAAHLLGYIREVDGEEVKTQPD
VYTPGDYIGASGLEKTYENELRGKKGIAYVLRDKLGRYAGAYRDGKDDIPVIPGKDIKTT
VDLDLQQYAEYLLSNKRAGVVAIEPSTGEILAMVTTPNYDPNELTITNNARGDVYKKLAA
DPNIPLFNRAVMAQYPPGSIHKTILALIGQQIGVWDVDRGVSCGGAYVAPGVRLGCHRHA
YCSDLRTGIQHSCNAYFVTLFRTIVDMYGYKHPNRGLDTLNYYLNKFGYGRKLGIDYPGE
QSGRFPTSEFFDRWYARDGQWKSIWIRSLGIGQGEMLCTNIQLANLAAIIANRGHFYTPH
FFKAFGDSSTTTSNRFRTKNLVGIDRKHFDPVVDGMERVTIAGTARRAFIPDIPICGKTG
TAENNSGEDHSIFFCFAPKDNPRIAIAVYAENAGFGGSVAAPVASLMIEKYLKGEIRSPQ
RKEMEKMVLKKDYIIREVALKNGKTDQP
Download sequence
Identical sequences F4KXP8
gi|332665494|ref|YP_004448282.1| WP_013765949.1.50710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]