SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013769830.1.46799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013769830.1.46799
Domain Number 1 Region: 148-473
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.79e-16
Family Phase 1 flagellin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013769830.1.46799
Sequence length 480
Comment flagellar hook-associated protein FlgK [Cellulomonas fimi]; AA=GCF_000212695.1; RF=representative genome; TAX=590998; STAX=1708; NAME=Cellulomonas fimi ATCC 484; strain=ATCC 484; AL=Complete Genome; RT=Major
Sequence
MSTFSGLGTALSSLIAQRQALDVAGQNVANANTVGYTRQRASMSALPAAQVPSMFSVNHG
AGEGVRVTGIERLGDVFLDMRLRTQTGGASYLAARADAYATLEKSLGEPGETGLASQLAT
MWGAWADLSNTPDKDSARAVVMQESTAVADRIATLYTAARTQWTQALSTTTALVDKVNTT
AAGVADLNARILEITNSGGTANELADQRDLLVMDLASLVGASAVTRENGQVDVLVGGNAL
VSGKRAHALEVQGARSFAQATGDTATPGQPVTVVWAERPTQSAGLDGGRVAGLLSVLAPA
GPGGTGGPLVEAAARYDALAQTIATKVNAFHSTAVTTTGAAGGDFWAVDGPEPPALALRI
AVADRSAIAVAAAGAGALDGSVGDQIAALKTDETGPDAHWSATVVDLGVRAASASARSKV
AESARVTAQQQQLAATSVDTDEETVNMLAFQRAYEGAARVLTAVDEMLDTLINRTGLVGR
Download sequence
Identical sequences F4GYT2
WP_013769830.1.46799 gi|332669180|ref|YP_004452188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]