SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013770368.1.46799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013770368.1.46799
Domain Number 1 Region: 30-334
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.79e-47
Family ADP-ribosylglycohydrolase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013770368.1.46799
Sequence length 343
Comment hypothetical protein [Cellulomonas fimi]; AA=GCF_000212695.1; RF=representative genome; TAX=590998; STAX=1708; NAME=Cellulomonas fimi ATCC 484; strain=ATCC 484; AL=Complete Genome; RT=Major
Sequence
MLRPVGPWPGHRHTPPATDGDPPVDDAQTALLDRAAGVLLAQAVGDALGVPYEFAPPFDG
PARMVGGGLGPYAPGEWSDDTQMSVCVARVAATGTDLTSDAALDAVADGFLAWLTGGASD
VGAQTRQVLTTETPGPGSAANLRARSAQLHDLTGRTAGNGALMRTGVVGLTALHDRERTA
AAARAVALLTHADDLAGDSCVLWSEAVRVAVLDARLDLLGGLDLLPPDRRDAWQTRIEDA
TGADPALFAPNGFTVTALQAAWAAITTTTAHDGTRHLPDALQAAVHAGDDTDTVAAIAGA
LLGARWGASAVPSDWRTAVHGWPGLTGEDLVDLGRRAARAGCA
Download sequence
Identical sequences F4H3C1
gi|332669721|ref|YP_004452729.1| WP_013770368.1.46799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]