SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013772002.1.46799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013772002.1.46799
Domain Number 1 Region: 67-255
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.28e-41
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 2 Region: 341-492
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-25
Family Phosphoglucomutase, first 3 domains 0.004
Further Details:      
 
Domain Number 3 Region: 243-352
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-22
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 
Domain Number 4 Region: 494-589
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.14e-16
Family Phosphoglucomutase, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013772002.1.46799
Sequence length 615
Comment phosphomannomutase [Cellulomonas fimi]; AA=GCF_000212695.1; RF=representative genome; TAX=590998; STAX=1708; NAME=Cellulomonas fimi ATCC 484; strain=ATCC 484; AL=Complete Genome; RT=Major
Sequence
MTDEGWAALEARVQAWIDDDPDPQTADELRGLLTTARTGPEGLLPGHDPDPTQRQAIDAR
AAARAELADRFQGLLQFGTAGLRGRLAGGPHRMNRAVVVRAAAGIADFLLGELDGVTPPP
RVVVGYDARHNSAQFALDTAGVLTAVGIEVLLLPEPLPTPVLAFCVRHLDADAGIMVTAS
HNPPQDNGYKVYLGGRVVTDAGQGAQIVPPTDTAIAAEIARVPSVASVPRADHGWTVLGQ
DVVDAYVRTVVGLADLSPEARAAAGDLRIVLTPLHGVGGRVAQRVLAEAGFTDVLLVPEQ
EFPDPDFPSVAFPNPEEPGAIDLAIGLAGDERADLVLALDPDADRCAVAVQDLRSRSYRG
PDTAAAEGWRMLHGDETGALLGDLAARRAAAASRDHAVLASSIVSSRLLAEIARHAGLQH
RQTLTGFKWISRVDGLVFGYEEALGYCVDPAHVRDKDGISAALTVAGLAATLKAQGRSPV
DALDDLARAHGLHLTGQVSARFADLADIGATVQRLRATPPRTLAGVPVTSVVDLAAGTED
DRDGLPPTDGLRMFTSDGTRVIVRPSGTEPKVKCYLEVVEPVAADADDDAVTHARRSARA
RLDALAADVRTVLGL
Download sequence
Identical sequences F4H815
WP_013772002.1.46799 gi|332671355|ref|YP_004454363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]