SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013775137.1.74519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013775137.1.74519
Domain Number 1 Region: 238-583
Classification Level Classification E-value
Superfamily SIS domain 6.59e-78
Family double-SIS domain 0.0000247
Further Details:      
 
Domain Number 2 Region: 3-225
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.72e-45
Family Class II glutamine amidotransferases 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013775137.1.74519
Sequence length 585
Comment glutamine--fructose-6-phosphate transaminase (isomerizing) [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence
MGGIFGFICNSPKDVNVAINGLKRLVYRGYDSAGIVYMNGKLTVKKIVGNITKVDLQISG
TSRIVLAHTRYASRGWPTLENAHPLFDCNKKIALVMDGVIDDYEEIRDKLIKQGHKFVST
TDTEVLPHLLENSQDYIRSSIEIIKNIKGIYSFAFIVDGINKIFAGSAGQPIVIGITQEC
KYVSSDLPSLNGFAENAIILPENSVAEISEDYVKIFDIQGNQITVQPKRVKYQEEIVDKG
GYPHFMLKEIYDIPSALISSFTSLMEKYLSLSAMIVYGAKNVYVIGNGTSLHAGLISSYY
FAEVGINVNVVSAAEFPYYALENIGTGSVIIAISQSGETADVIRSVKMAKQRGAVIVGIT
NSVGSRLALESNVYLPITAGPELAVPATKTFTSTLVVLRTLSLYTGLNSGKKSKSDIEKL
KEDLNNLSKALSSNLPQIEKQAEDAVAKINSESMYVTSSGINFPVAMEGALKFKEASLTH
AEGIQLGELLHGPIALTNKGYPIVVIKPAEEQAYDLYNKVVKSISDRGSPIILISNDGML
KSVETTRELSPIANVVPLQLMAYKLGVKKSLPIDTPPGLVKAVVS
Download sequence
Identical sequences F4B5C7
gi|332796019|ref|YP_004457519.1| WP_013775137.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]