SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013775415.1.74519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013775415.1.74519
Domain Number - Region: 62-129
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00562
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013775415.1.74519
Sequence length 231
Comment CopG family transcriptional regulator [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence
MKTLVIKLTDEEYKQLEEEASKQGFAILSYYVKYKLLSSPSNDGINTSTTMTSSNITPQI
IDEITKKLERKIQDMVNPFTAEVENLKQKIADLSEKIDELESKKSEESEAKYEKQRQYSQ
PSGEKKKTVMDILKSQGAIYESEVKLKNPDLFFEKIEKQGGKVLYTDKERIAVDVDFFNN
FVKKLSDIHTSDDVEAQKYLTKQEHKLFQKLRQLGIIYFDNNTKAWKLSGI
Download sequence
Identical sequences F4B716
WP_013775415.1.74519 gi|332796297|ref|YP_004457797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]