SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013777011.1.74519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013777011.1.74519
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.43e-47
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000439
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.7e-28
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013777011.1.74519
Sequence length 278
Comment carbon monoxide dehydrogenase [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence
MYPPKIGYVIPDNLNEAIDFLKAHDDAKALAGGHSLIPMLKLRIIRPSYLVDITKLKELH
YLNKEEKEYKLGATITHYEISKAQIPLLSEVASKIGDPQVRNMGTIGGSISQLDPSADYP
AALLVLDAKVKIKGPSGERLEEFSSFDKDMFTPDLSQGEIVTEISIPVFPGYKYSYQKLE
RKAGDYAIVGVAVLIKTNGDEVEDFRVGVTGVNNKAYRSQIAEDMIKGKKINDEIIDKVA
QEVANESNPTSDIRGSAEYKRKATKVMTKRAILDALKR
Download sequence
Identical sequences F4B9F0
gi|332797894|ref|YP_004459394.1| WP_013777011.1.74519 2014259330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]