SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013777339.1.59919 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013777339.1.59919
Domain Number 1 Region: 81-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-25
Family Translational machinery components 0.0002
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.03e-22
Family Ribosomal S5 protein, N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013777339.1.59919
Sequence length 168
Comment 30S ribosomal protein S5 [Tepidanaerobacter acetatoxydans]; AA=GCF_000213235.1; RF=na; TAX=1209989; STAX=499229; NAME=Tepidanaerobacter acetatoxydans Re1; strain=Re1; AL=Complete Genome; RT=Major
Sequence
MQHRNRNVEESEFVEKIVSINRVAKVVKGGKNFRFAVLVVVGNKKGKVGVGTGKAQEIPE
AIRKGIEDAKKNLIDVPILNGTIPHESIGIFGAGKVLLKPAPEGTGVIAGGPVRAVVELA
GITDIVSKSLGSANARNMVNATIVALKQLKRAEEVAKLRNKTVEEILG
Download sequence
Identical sequences F4LSV2
gi|332798223|ref|YP_004459722.1| WP_013777339.1.59919 WP_013777339.1.8343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]