SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013789520.1.13474 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013789520.1.13474
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.18e-37
Family N-acetyl transferase, NAT 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013789520.1.13474
Sequence length 159
Comment N-acetyltransferase [Pseudomonas fulva]; AA=GCF_000213805.1; RF=representative genome; TAX=743720; STAX=47880; NAME=Pseudomonas fulva 12-X; strain=12-X; AL=Complete Genome; RT=Major
Sequence
MTLNIRPAVREDAALILRFITDLAIYEKAEHEVKTDVAGIENSLFGEGSTAHGLICELNG
EPMGYAVYFFNYSTWLGKHGLYLEDLYITPQQRGVGAGKALLRHLAKLAVARGCGRFEWS
VLDWNTPAIEFYDSIGAKPQNEWIGYRLTGEALTSFAAG
Download sequence
Identical sequences F6AGP9
WP_013789520.1.13474 gi|333898599|ref|YP_004472472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]