SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013794845.1.19944 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013794845.1.19944
Domain Number 1 Region: 4-546
Classification Level Classification E-value
Superfamily SIS domain 7.79e-207
Family Phosphoglucose isomerase, PGI 0.0000000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013794845.1.19944
Sequence length 548
Comment glucose-6-phosphate isomerase [Marinomonas posidonica]; AA=GCF_000214215.1; RF=representative genome; TAX=491952; STAX=936476; NAME=Marinomonas posidonica IVIA-Po-181; strain=IVIA-Po-181; AL=Complete Genome; RT=Major
Sequence
MRSPTEFSAWKKLAEHQQEMISVDMTSLFQADPKRADKYQAQAAGWTLDYAKNRANDTTL
SLLTELANEAGMKNAIDGMFSGAHINNTEDRSVLHVALRASQAQDTLMVDGVNVLAEVRA
TLKQMEQFVAQLHTGEWQGYTGKAITDVVSIGIGGSYLGPKVVAEALTPYKKDSIKVHFV
ANIDGSDITGKLKQLNPETTLFVISSKTFGTLETLSNANAARDWFLSNGGSQDNVSKHFA
AVSSNVKKAVDFGMAKENIFPMWDWVGGRYSLWSAIGLPVAIAVGMDNFYELLDGAHQMD
EHFRTAPLEENLPVIMGVLGVWYINFHNAQTHALIPYDHYLRAMPAHIQQLDMESNGKAN
LLNGDAVETDTGPIIWGGAGTNGQHAYHQLLHQGTRLVPVDFIAPLTSHNPIAEHHTHLF
ANCLSQSQALMVGKTLEQAQQELKDAGATDEQVAKIAPHKVIKGNRPSNTLLTDKMTPAS
VGALIALYEHRTFVQGTIWGINSFDQWGVELGKVLGTDIYNRLVSNSDNSALDASTQALI
KAFKKAQH
Download sequence
Identical sequences F6CXQ5
gi|333906701|ref|YP_004480287.1| WP_013794845.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]