SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013819428.1.77941 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013819428.1.77941
Domain Number 1 Region: 15-67
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000392
Family TTHA0281-like 0.07
Further Details:      
 
Domain Number 2 Region: 73-113
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000104
Family VCA0319-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013819428.1.77941
Sequence length 159
Comment toxin-antitoxin system HicB family antitoxin [Methylomonas methanica]; AA=GCF_000214665.1; RF=representative genome; TAX=857087; STAX=421; NAME=Methylomonas methanica MC09; strain=MC09; AL=Complete Genome; RT=Major
Sequence
MIDPSNYNITVRKGWFDGEHCYEARVAELPDVAEYADSFEEAYALAIDTIEVTAEMLAAQ
GKAIPSPMIPADEYSGRVTLRLAKSLHRSLAQAADMEGVSLNQHLTNILNYYAGYAQGLE
ARNSSENTSWQLASQTEKQYKHLRLISTSEPNALEKQYA
Download sequence
Identical sequences G0A055
WP_013819428.1.77941 gi|333984483|ref|YP_004513693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]