SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013824633.1.26247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013824633.1.26247
Domain Number 1 Region: 2-211
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-63
Family Phosphate binding protein-like 0.0000241
Further Details:      
 
Domain Number 2 Region: 214-286
Classification Level Classification E-value
Superfamily GlnB-like 6.11e-21
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013824633.1.26247
Sequence length 286
Comment ATP phosphoribosyltransferase [Methanobacterium paludis]; AA=GCF_000214725.1; RF=representative genome; TAX=868131; STAX=868131; NAME=Methanobacterium paludis; strain=SWAN1; AL=Complete Genome; RT=Major
Sequence
MQIRIALPSKGRISDPAVQLLGKAGIGVKDTANRKLFSETYDNEISVMFTRAADIPEFVA
DGAADLGVTGFDLIEENNADVEILEDLNFGRTKLVLAVPETSPINGINDITDGAVVATEF
PHLTDKYLKSKGITAKIVELSGSTEIAPFIGVADIISDLTSTGTTLKMNHLKIIETVLES
SIKLIANKKSFKKNNEKIEAIRTGIKGVIDAEGKKLVMMNVAEEFLDEVQKAMPGLTGPT
VSQVLSKKGIMAVHAVVDERDVFNLVNQLKKIGARDILVVPIERII
Download sequence
Identical sequences F6D7Q2
gi|333986325|ref|YP_004518932.1| WP_013824633.1.26247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]