SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013825770.1.26247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013825770.1.26247
Domain Number 1 Region: 116-254
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.82e-31
Family MJ1460-like 0.0059
Further Details:      
 
Domain Number 2 Region: 23-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-17
Family Hypothetical protein PH1932 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013825770.1.26247
Sequence length 258
Comment ArsR family transcriptional regulator [Methanobacterium paludis]; AA=GCF_000214725.1; RF=representative genome; TAX=868131; STAX=868131; NAME=Methanobacterium paludis; strain=SWAN1; AL=Complete Genome; RT=Major
Sequence
MNNMNPEDPHQDMRIELFATPDSVYAIDSPVRVKILSLLREGELSFDKIAELSGKAKSTV
SVHLKKMAKEGIIGSKQDPDDARKKIFFIKSEYLGKLSSKKMLKDGIDKYVSSYVESNGN
PFEFFRMIFQTIRVSLLKQGINIDPILYEAGEKVGEAIYKELADSDMDKFVGNIAKFWET
HELGHVEVGNLEPLTVNVYDCFECQGLPYLGRPACAFDSGILKTIFSAHFQDEQAVNEVK
CYATGDDYCSFVIKDCKK
Download sequence
Identical sequences F6D656
WP_013825770.1.26247 gi|333987463|ref|YP_004520070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]