SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013832924.1.5499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013832924.1.5499
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily YccV-like 6.15e-34
Family YccV-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013832924.1.5499
Sequence length 126
Comment DNA-binding protein [Novosphingobium sp. PP1Y]; AA=GCF_000253255.1; RF=na; TAX=702113; STAX=702113; NAME=Novosphingobium sp. PP1Y; strain=PP1Y; AL=Complete Genome; RT=Major
Sequence
MNRASFFSPQAGRVIDAPFQTRARFAIGDVVRHKQHDFRGVIFDIDPVFANSEEWYQSIP
LELRPSREQPYYHLLAENEDSSYVAYVSQQNLLEDAEGGPVDHPSVSEIFEEFRNGRYQL
RRGLAH
Download sequence
Identical sequences F6IMA8
gi|334141172|ref|YP_004534378.1| WP_013832924.1.5499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]