SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013841254.1.34695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013841254.1.34695
Domain Number 1 Region: 172-360
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-58
Family Methylesterase CheB, C-terminal domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 3-123
Classification Level Classification E-value
Superfamily CheY-like 9.82e-31
Family CheY-related 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013841254.1.34695
Sequence length 361
Comment chemotaxis response regulator protein-glutamate methylesterase [Desulfotomaculum ruminis]; AA=GCF_000215085.1; RF=representative genome; TAX=696281; STAX=1564; NAME=Desulfotomaculum ruminis DSM 2154; strain=DSM 2154; AL=Complete Genome; RT=Major
Sequence
MQVKVLVVDDSSLMRRLISRLLEEDKEIKVIGTAADGLEALQQIKALKPDVVSMDVEMPK
LDGIATLRRVMRECPVPIVMLSAHTHEGARATMEALSAGAVDFVPKPSKSTELPVMVADL
KTKLKVAARVSMRRVARPVLPPRSTISRETAPPAPPKVPALPIRKQRNCAKIDLVVIGCS
TGGPAALQQIIPFLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSGITVRHAEEGDEVKPG
LVLVSPAGYDLSFKAKGSGTAITLSNQGAPLAPGGFRPSVDWVMKSAAEVYGCRAMGVLL
TGMGRDGAQGMLAIKQQGGPTMAEHESTCVVYGMPKAAVDLGAAQKIVPLTQMAQEIQSI
F
Download sequence
Identical sequences F6DN25
WP_013841254.1.34695 gi|334339789|ref|YP_004544769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]