SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013841466.1.34695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013841466.1.34695
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily CheY-like 2.7e-42
Family CheY-related 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013841466.1.34695
Sequence length 228
Comment DNA-binding response regulator [Desulfotomaculum ruminis]; AA=GCF_000215085.1; RF=representative genome; TAX=696281; STAX=1564; NAME=Desulfotomaculum ruminis DSM 2154; strain=DSM 2154; AL=Complete Genome; RT=Major
Sequence
MGFNMNKILVVEDEDILREVIIDYLIEDGYQALEAADGETALELFQSNSVDLVILDIVLP
KLDGWSVCRRIRKNSSIPIIILTARSDEDDSLLGYELGADDYLIKPYSPRVLMAKVKRFL
EKYSGTVDGMLISAGGIVINRGSRLVSVDGNTINLTHTEFEILAYLMQNKGTVITREQLI
AKIWGYNFYGDEKTVNSHIRNLRAKLGSKGACIVTVIRSGYKFEEERL
Download sequence
Identical sequences F6DQB8
gi|334340002|ref|YP_004544982.1| WP_013841466.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]